PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g051440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 296aa    MW: 33019.6 Da    PI: 9.8224
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g051440.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind333.65.4e-10212951301
       GAGA_bind   1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalve 76 
                     m++ g+++  r+k+ y +                ++++l   +++++ms++aerda+i+ern+a+s+kk+ava+rd+a++qrdkal+er+kal+e
  Csa07g051440.1   1 MENGGQYDngRFKPdYLKgaqsvwnmmpqhqikeQHNALV--MNKKIMSILAERDAAIHERNQAVSAKKEAVAARDEALQQRDKALSERDKALIE 93 
                     8899998888999967779999999998877754446666..99*************************************************** PP

       GAGA_bind  77 rdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkks 171
                     rdn+++al+++ensl++al       sg k  d          +d++v+  e +kl ++p++  ++e++ ++k+ kr++  +  ++ + k kk +
  Csa07g051440.1  94 RDNAYAALQHHENSLNFAL-------SGGKRDD----------GDDCVG-VEPHKLAVFPLSAIPPEVTSTTKVAKRKK--ES-KQGQVKIKKVG 167
                     *************966554.......7777666..........788999.88999***********9999888873333..22.33444778889 PP

       GAGA_bind 172 ekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                     e+ +++v++++  ++s+++++s++++ln v++De+t+PvP+C+CtG+ rqCYkWGnGGWqS+CCttt+S yPLP+++++r++R++grKmS+++f+
  Csa07g051440.1 168 EDLNRRVAAPG--KKSRKDWDSLEVGLNLVTFDETTMPVPMCTCTGSARQCYKWGNGGWQSSCCTTTLSLYPLPQMPNKRHSRMGGRKMSGNVFS 260
                     999********..56******************************************************************************** PP

       GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +lL++LaaeGydls+pvDLkd+WA+HGtn+++ti+
  Csa07g051440.1 261 RLLSRLAAEGYDLSCPVDLKDYWARHGTNRYITIK 295
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012266.4E-1661295IPR010409GAGA-binding transcriptional activator
PfamPF062179.0E-9413295IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MENGGQYDNG RFKPDYLKGA QSVWNMMPQH QIKEQHNALV MNKKIMSILA ERDAAIHERN  60
QAVSAKKEAV AARDEALQQR DKALSERDKA LIERDNAYAA LQHHENSLNF ALSGGKRDDG  120
DDCVGVEPHK LAVFPLSAIP PEVTSTTKVA KRKKESKQGQ VKIKKVGEDL NRRVAAPGKK  180
SRKDWDSLEV GLNLVTFDET TMPVPMCTCT GSARQCYKWG NGGWQSSCCT TTLSLYPLPQ  240
MPNKRHSRMG GRKMSGNVFS RLLSRLAAEG YDLSCPVDLK DYWARHGTNR YITIK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290900.0AK229090.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-37-J01.
GenBankAK3171650.0AK317165.1 Arabidopsis thaliana AT2G21240 mRNA, complete cds, clone: RAFL21-54-A06.
GenBankAY0845540.0AY084554.1 Arabidopsis thaliana clone 111536 mRNA, complete sequence.
GenBankBT0261090.0BT026109.1 Arabidopsis thaliana At2g21240 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416867.10.0PREDICTED: protein BASIC PENTACYSTEINE4-like
SwissprotQ8S8C60.0BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLR0FWU30.0R0FWU3_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__42__AT2G21240.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.20.0basic pentacysteine 4